Lineage for d1ozaa1 (1oza A:1-133,A:358-371)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1578283Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1578326Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species)
  7. 1578338Species Haemophilus influenzae [TaxId:727] [102159] (12 PDB entries)
    Uniprot P44801
  8. 1578347Domain d1ozaa1: 1oza A:1-133,A:358-371 [104045]
    Other proteins in same PDB: d1ozaa2
    mutant

Details for d1ozaa1

PDB Entry: 1oza (more details), 2.06 Å

PDB Description: crystal structure of the r103l mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae
PDB Compounds: (A:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d1ozaa1:

Sequence, based on SEQRES records: (download)

>d1ozaa1 c.2.1.3 (A:1-133,A:358-371) Aspartate beta-semialdehyde dehydrogenase {Haemophilus influenzae [TaxId: 727]}
mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqagqkapvfggkdagdlksafd
ieelkkldiivtcqggdytnevypklkatgwdgywvdaasallmkddaiivldpvnqhvi
seglkkgiktfvgXaaepvrrilkqlva

Sequence, based on observed residues (ATOM records): (download)

>d1ozaa1 c.2.1.3 (A:1-133,A:358-371) Aspartate beta-semialdehyde dehydrogenase {Haemophilus influenzae [TaxId: 727]}
mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqalksafdieelkkldiivtcq
ggdytnevypklkatgwdgywvdaasallmkddaiivldpvnqhviseglkkgiktfvgX
aaepvrrilkqlva

SCOPe Domain Coordinates for d1ozaa1:

Click to download the PDB-style file with coordinates for d1ozaa1.
(The format of our PDB-style files is described here.)

Timeline for d1ozaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ozaa2