Lineage for d1owqa2 (1owq A:240-307)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 601019Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 601184Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 601185Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 601296Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
    secreted during involution
  7. 601299Species Cow (Bos taurus) [TaxId:9913] [110872] (1 PDB entry)
  8. 601300Domain d1owqa2: 1owq A:240-307 [104042]
    Other proteins in same PDB: d1owqa1
    complexed with nag

Details for d1owqa2

PDB Entry: 1owq (more details), 2 Å

PDB Description: crystal structure of a 40 kda signalling protein (spc-40) secreted during involution

SCOP Domain Sequences for d1owqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1owqa2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Cow (Bos taurus)}
fgrsytlassktdvgapisgpgipgqftkekgtlayyeicdflhgatthrfrdqqvpyat
kgnqwvay

SCOP Domain Coordinates for d1owqa2:

Click to download the PDB-style file with coordinates for d1owqa2.
(The format of our PDB-style files is described here.)

Timeline for d1owqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1owqa1