SCOPe 2.05: Domain d1owca_: 1owc A:

Lineage for d1owca_ (1owc A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.103: Citrate synthase [48255] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.103.1: Citrate synthase [48256] (2 families)

5. Family a.103.1.1: Citrate synthase [48257] (2 proteins)
   duplication: large domain consists of two structural repeats
   the second repeat is interrupted by the small domain
   automatically mapped to Pfam PF00285

6. Protein Citrate synthase [48258] (7 species)

7. Species Escherichia coli [TaxId:562] [81862] (9 PDB entries)
   Uniprot P00891

8. Domain d1owca_: 1owc A: [104039]
   complexed with so4

Details for d1owca_

PDB Entry: 1owc, 2.2 Å

PDB Description: three dimensional structure analysis of the r109l variant of the type ii citrate synthase from e. coli

PDB Compounds: (A:) citrate synthase

SCOPe Domain Sequences for d1owca_:

Sequence; same for both SEQRES and ATOM records:

>d1owca_ a.103.1.1 (A:) Citrate synthase {Escherichia coli [TaxId: 562]}
adtkakltlngdtaveldvlkgtlgqdvidirtlgskgvftfdpgftstasceskitfid
gdegillhrgfpidqlatdsnylevcyillngekptqeqydefkttvtlhtmiheqitrl
fhafrrdshpmavmcgitgalaafyhdsldvnnprhreiaafrllskmptmaamcykysi
gqpfvyprndlsyagnflnmmfstpcepyevnpileramdrililhadheqnaststvrt
agssganpfaciaagiaslwgpahgganeaalkmleeissvkhipeffrrakdkndsfrl
mgfghrvyknydpratvmretchevlkelgtkddllevamelenialndpyfiekklypn
vdfysgiilkamgipssmftvifamartvgwiahwsemhsdgmkiarprqlytgyekrdf
ksdikr

Timeline for d1owca_:

• d1owca_ first appeared in SCOP 1.69
  
• d1owca_ appears in SCOPe 2.04
  
• d1owca_ appears in SCOPe 2.06
  
• d1owca_ appears in the current release, SCOPe 2.08