Lineage for d1owca_ (1owc A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004800Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2004801Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2004802Family a.103.1.1: Citrate synthase [48257] (2 protein domains)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. 2004803Protein Citrate synthase [48258] (7 species)
  7. 2004823Species Escherichia coli [TaxId:562] [81862] (12 PDB entries)
    Uniprot P00891
  8. 2004828Domain d1owca_: 1owc A: [104039]
    complexed with so4

Details for d1owca_

PDB Entry: 1owc (more details), 2.2 Å

PDB Description: Three Dimensional Structure Analysis Of The R109L Variant of the Type II Citrate Synthase From E. Coli
PDB Compounds: (A:) citrate synthase

SCOPe Domain Sequences for d1owca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1owca_ a.103.1.1 (A:) Citrate synthase {Escherichia coli [TaxId: 562]}
adtkakltlngdtaveldvlkgtlgqdvidirtlgskgvftfdpgftstasceskitfid
gdegillhrgfpidqlatdsnylevcyillngekptqeqydefkttvtlhtmiheqitrl
fhafrrdshpmavmcgitgalaafyhdsldvnnprhreiaafrllskmptmaamcykysi
gqpfvyprndlsyagnflnmmfstpcepyevnpileramdrililhadheqnaststvrt
agssganpfaciaagiaslwgpahgganeaalkmleeissvkhipeffrrakdkndsfrl
mgfghrvyknydpratvmretchevlkelgtkddllevamelenialndpyfiekklypn
vdfysgiilkamgipssmftvifamartvgwiahwsemhsdgmkiarprqlytgyekrdf
ksdikr

SCOPe Domain Coordinates for d1owca_:

Click to download the PDB-style file with coordinates for d1owca_.
(The format of our PDB-style files is described here.)

Timeline for d1owca_: