![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.103.1: Citrate synthase [48256] (1 family) ![]() |
![]() | Family a.103.1.1: Citrate synthase [48257] (1 protein) duplication: large domain consists of two structural repeats the second repeat is interrupted by the small domain |
![]() | Protein Citrate synthase [48258] (7 species) |
![]() | Species Escherichia coli [TaxId:562] [81862] (5 PDB entries) |
![]() | Domain d1owbb_: 1owb B: [104038] complexed with nad, sul; mutant |
PDB Entry: 1owb (more details), 2.2 Å
SCOP Domain Sequences for d1owbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1owbb_ a.103.1.1 (B:) Citrate synthase {Escherichia coli} adtkakltlngdtaveldvlkgtlgqdvidirtlgskgvftfdpgftstasceskitfid gdegillhrgfpidqlatdsnylevcyillngekptqeqydefkttvtlhtmiheqitrl fhafrrdshpmavmcgitgalaafyhdsldvnnprhreiaafrllskmptmaamcykysi gqpfvyprndlsyagnflnmmfstpcepyevnpileramdrililhadheqnaststvrt agssganpfaciaagiaslwgpahgganeaalkmleeissvkhipeffrrakdkndsfrl mgfghrvyknydpratvmretchevlkelgtkddllevamelenialndpyfiekklypn vdfysgiilkamgipssmftvifamartvgwiahwsemhsdgmkiarprqlytgyekrdf ksdikr
Timeline for d1owbb_: