Lineage for d1ovrc_ (1ovr C:)

  1. Root: SCOP 1.71
  2. 631074Class k: Designed proteins [58788] (42 folds)
  3. 631208Fold k.8: Designed four-helix bundle protein [58832] (1 superfamily)
  4. 631209Superfamily k.8.1: Designed four-helix bundle protein [58833] (1 family) (S)
  5. 631210Family k.8.1.1: Designed four-helix bundle protein [58834] (4 proteins)
    this is not a true family
  6. 631211Protein Artificial diiron protein [58837] (1 species)
    dimeric alpha-hairpin fold
  7. 631212Species Synthetic, different variants [58838] (9 PDB entries)
  8. 631237Domain d1ovrc_: 1ovr C: [104035]

Details for d1ovrc_

PDB Entry: 1ovr (more details), 2.99 Å

PDB Description: crystal structure of four-helix bundle model di-mn(ii)-df1-l13

SCOP Domain Sequences for d1ovrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ovrc_ k.8.1.1 (C:) Artificial diiron protein {Synthetic, different variants}
dylrellklelqlikqyrealeyvklpvlakiledeekhiewletilg

SCOP Domain Coordinates for d1ovrc_:

Click to download the PDB-style file with coordinates for d1ovrc_.
(The format of our PDB-style files is described here.)

Timeline for d1ovrc_: