![]() | Class k: Designed proteins [58788] (44 folds) |
![]() | Fold k.8: Designed four-helix bundle protein [58832] (1 superfamily) |
![]() | Superfamily k.8.1: Designed four-helix bundle protein [58833] (1 family) ![]() |
![]() | Family k.8.1.1: Designed four-helix bundle protein [58834] (4 proteins) this is not a true family |
![]() | Protein Artificial diiron protein [58837] (1 species) dimeric alpha-hairpin fold |
![]() | Species Synthetic, different variants [58838] (12 PDB entries) |
![]() | Domain d1ovrc_: 1ovr C: [104035] complexed with mn |
PDB Entry: 1ovr (more details), 2.99 Å
SCOPe Domain Sequences for d1ovrc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ovrc_ k.8.1.1 (C:) Artificial diiron protein {Synthetic, different variants} dylrellklelqlikqyrealeyvklpvlakiledeekhiewletilg
Timeline for d1ovrc_: