Lineage for d1ovrb_ (1ovr B:)

  1. Root: SCOPe 2.07
  2. 2652352Class k: Designed proteins [58788] (44 folds)
  3. 2652488Fold k.8: Designed four-helix bundle protein [58832] (1 superfamily)
  4. 2652489Superfamily k.8.1: Designed four-helix bundle protein [58833] (1 family) (S)
  5. 2652490Family k.8.1.1: Designed four-helix bundle protein [58834] (4 proteins)
    this is not a true family
  6. 2652491Protein Artificial diiron protein [58837] (1 species)
    dimeric alpha-hairpin fold
  7. 2652492Species Synthetic, different variants [58838] (12 PDB entries)
  8. 2652528Domain d1ovrb_: 1ovr B: [104034]
    complexed with mn

Details for d1ovrb_

PDB Entry: 1ovr (more details), 2.99 Å

PDB Description: crystal structure of four-helix bundle model di-mn(ii)-df1-l13
PDB Compounds: (B:) four-helix bundle model di-Mn(II)-DF1-L13

SCOPe Domain Sequences for d1ovrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ovrb_ k.8.1.1 (B:) Artificial diiron protein {Synthetic, different variants}
dylrellklelqlikqyrealeyvklpvlakiledeekhiewletilg

SCOPe Domain Coordinates for d1ovrb_:

Click to download the PDB-style file with coordinates for d1ovrb_.
(The format of our PDB-style files is described here.)

Timeline for d1ovrb_: