SCOPe 2.05: Domain d1ou6b2: 1ou6 B:269-392

Lineage for d1ou6b2 (1ou6 B:269-392)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (9 proteins)

6. Protein Biosynthetic thiolase [53905] (1 species)

7. Species Zoogloea ramigera [TaxId:350] [53906] (16 PDB entries)
   Uniprot P07097

8. Domain d1ou6b2: 1ou6 B:269-392 [104028]
   complexed with 168, so4

Details for d1ou6b2

PDB Entry: 1ou6, 2.07 Å

PDB Description: Biosynthetic thiolase from Zoogloea ramigera in complex with acetyl-O-pantetheine-11-pivalate

PDB Compounds: (B:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d1ou6b2:

Sequence; same for both SEQRES and ATOM records:

>d1ou6b2 c.95.1.1 (B:269-392) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]}
iqplgrivswatvgvdpkvmgtgpipasrkaleragwkigdldlveaneafaaqacavnk
dlgwdpsivnvnggaiaighpigasgarilntllfemkrrgarkglatlcigggmgvamc
iesl

Timeline for d1ou6b2:

• d1ou6b2 first appeared in SCOP 1.69
  
• d1ou6b2 appears in SCOPe 2.04
  
• d1ou6b2 appears in SCOPe 2.06
  
• d1ou6b2 appears in the current release, SCOPe 2.08