![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.1: Thiolase-related [53902] (20 proteins) |
![]() | Protein Biosynthetic thiolase, N-terminal domain [419020] (1 species) |
![]() | Species Zoogloea ramigera [TaxId:350] [419502] (16 PDB entries) Uniprot P07097 |
![]() | Domain d1ou6b1: 1ou6 B:1-268 [104027] Other proteins in same PDB: d1ou6a2, d1ou6b2, d1ou6c2, d1ou6d2 complexed with 168, so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1ou6 (more details), 2.07 Å
SCOPe Domain Sequences for d1ou6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ou6b1 c.95.1.1 (B:1-268) Biosynthetic thiolase, N-terminal domain {Zoogloea ramigera [TaxId: 350]} stpsiviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpa gegqnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesms maphcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafav asqnkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegt vtagnasglndgaaaallmseaeasrrg
Timeline for d1ou6b1: