SCOPe 2.08: Domain d1ou6a1: 1ou6 A:1-268

Lineage for d1ou6a1 (1ou6 A:1-268)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (20 proteins)

6. Protein Biosynthetic thiolase, N-terminal domain [419020] (1 species)

7. Species Zoogloea ramigera [TaxId:350] [419502] (16 PDB entries)
   Uniprot P07097

8. Domain d1ou6a1: 1ou6 A:1-268 [104025]
   Other proteins in same PDB: d1ou6a2, d1ou6b2, d1ou6c2, d1ou6d2
   complexed with 168, so4
   has additional insertions and/or extensions that are not grouped together

Details for d1ou6a1

PDB Entry: 1ou6, 2.07 Å

PDB Description: Biosynthetic thiolase from Zoogloea ramigera in complex with acetyl-O-pantetheine-11-pivalate

PDB Compounds: (A:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d1ou6a1:

Sequence; same for both SEQRES and ATOM records:

>d1ou6a1 c.95.1.1 (A:1-268) Biosynthetic thiolase, N-terminal domain {Zoogloea ramigera [TaxId: 350]}
stpsiviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpa
gegqnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesms
maphcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafav
asqnkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegt
vtagnasglndgaaaallmseaeasrrg

Timeline for d1ou6a1:

• d1ou6a1 first appeared in SCOP 1.69
  
• d1ou6a1 appears in SCOPe 2.07