SCOPe 2.06: Domain d1osdb_: 1osd B:

Lineage for d1osdb_ (1osd B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families)

5. Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)

6. Protein Mercuric ion binding protein MerP [55010] (2 species)

7. Species Ralstonia metallidurans CH34 [TaxId:266264] [110979] (1 PDB entry)
   Uniprot O66016 Q58AI1 Q5NUU9 Q6UP70 Q7BRH5 Q7BRH6 Q7X3A5 # 100% identity

8. Domain d1osdb_: 1osd B: [104023]

Details for d1osdb_

PDB Entry: 1osd, 2 Å

PDB Description: crystal structure of oxidized merp from ralstonia metallidurans ch34

PDB Compounds: (B:) hypothetical protein MerP

SCOPe Domain Sequences for d1osdb_:

Sequence; same for both SEQRES and ATOM records:

>d1osdb_ d.58.17.1 (B:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]}
atqtvtlsvpgmtcsacpitvkkaiskvegvskvdvtfetrqavvtfddaktsvqkltka
tadagypssvkq

Timeline for d1osdb_:

• d1osdb_ first appeared in SCOP 1.69
  
• d1osdb_ appears in SCOPe 2.05
  
• d1osdb_ appears in SCOPe 2.07
  
• d1osdb_ appears in the current release, SCOPe 2.08