![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) ![]() |
![]() | Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins) |
![]() | Protein Mercuric ion binding protein MerP [55010] (2 species) |
![]() | Species Ralstonia metallidurans CH34 [TaxId:266264] [110979] (1 PDB entry) Uniprot O66016 Q58AI1 Q5NUU9 Q6UP70 Q7BRH5 Q7BRH6 Q7X3A5 # 100% identity |
![]() | Domain d1osdb_: 1osd B: [104023] |
PDB Entry: 1osd (more details), 2 Å
SCOPe Domain Sequences for d1osdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1osdb_ d.58.17.1 (B:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} atqtvtlsvpgmtcsacpitvkkaiskvegvskvdvtfetrqavvtfddaktsvqkltka tadagypssvkq
Timeline for d1osdb_: