Lineage for d1osda_ (1osd A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) 
Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins) 
Protein Mercuric ion binding protein MerP [55010] (2 species) Species Ralstonia metallidurans CH34 [TaxId:266264] [110979] (1 PDB entry)
Uniprot O66016 Q58AI1 Q5NUU9 Q6UP70 Q7BRH5 Q7BRH6 Q7X3A5 # 100% identity
Domain d1osda_: 1osd A: [104022]
Details for d1osda_
PDB Entry: 1osd (more details), 2 Å
PDB Description: crystal structure of oxidized merp from ralstonia metallidurans ch34
PDB Compounds: (A:) hypothetical protein MerPSCOPe Domain Sequences for d1osda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]}
atqtvtlsvpgmtcsacpitvkkaiskvegvskvdvtfetrqavvtfddaktsvqkltka
tadagypssvkq
SCOPe Domain Coordinates for d1osda_:
Click to download the PDB-style file with coordinates for d1osda_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1osda_:
- d1osda_ first appeared in SCOP 1.69
- d1osda_ appears in SCOPe 2.07
View in 3D
