SCOPe 2.08: Domain d1oqaa1: 1oqa A:2-110

Lineage for d1oqaa1 (1oqa A:2-110)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.15: BRCT domain [52112] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.15.1: BRCT domain [52113] (6 families)
   Pfam PF00533

5. Family c.15.1.3: BRCT domain [63955] (1 protein)

6. Protein Breast cancer associated protein, BRCA1 [63956] (2 species)
   duplication: tandem repeat of BRCT domain

7. Species Human (Homo sapiens) [TaxId:9606] [63957] (15 PDB entries)
   Uniprot P38398 1649-1863

8. Domain d1oqaa1: 1oqa A:2-110 [104021]
   Other proteins in same PDB: d1oqaa2
   C-terminal domain only

Details for d1oqaa1

PDB Entry: 1oqa

PDB Description: solution structure of the brct-c domain from human brca1

PDB Compounds: (A:) breast cancer type 1 susceptibility protein

SCOPe Domain Sequences for d1oqaa1:

Sequence; same for both SEQRES and ATOM records:

>d1oqaa1 c.15.1.3 (A:2-110) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]}
sqdrkifrgleiccygpftnmptdqlewmvqlcgasvvkelssftlgtgvhpivvvqpda
wtedngfhaigqmceapvvtrewvldsvalyqcqeldtylipqiphshy

Timeline for d1oqaa1:

• d1oqaa1 first appeared in SCOP 1.69, called d1oqaa_
  
• d1oqaa1 appears in SCOPe 2.07