![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.15: BRCT domain [52112] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.15.1: BRCT domain [52113] (6 families) ![]() Pfam PF00533 |
![]() | Family c.15.1.3: BRCT domain [63955] (1 protein) |
![]() | Protein Breast cancer associated protein, BRCA1 [63956] (2 species) duplication: tandem repeat of BRCT domain |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63957] (15 PDB entries) Uniprot P38398 1649-1863 |
![]() | Domain d1oqaa1: 1oqa A:2-110 [104021] Other proteins in same PDB: d1oqaa2 C-terminal domain only |
PDB Entry: 1oqa (more details)
SCOPe Domain Sequences for d1oqaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oqaa1 c.15.1.3 (A:2-110) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} sqdrkifrgleiccygpftnmptdqlewmvqlcgasvvkelssftlgtgvhpivvvqpda wtedngfhaigqmceapvvtrewvldsvalyqcqeldtylipqiphshy
Timeline for d1oqaa1: