SCOPe 2.05: Domain d1op2a_: 1op2 A:

Lineage for d1op2a_ (1op2 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Venom serine protease [50570] (2 species)

7. Species Hundred-pace snake (Agkistrodon acutus) [TaxId:36307] [110238] (2 PDB entries)
   Uniprot Q9I8X1

8. Domain d1op2a_: 1op2 A: [104020]
   complexed with nag, so4

Details for d1op2a_

PDB Entry: 1op2, 2.1 Å

PDB Description: crystal structure of aav-sp-ii, a glycosylated snake venom serine proteinase from agkistrodon acutus

PDB Compounds: (A:) Venom serine proteinase

SCOPe Domain Sequences for d1op2a_:

Sequence; same for both SEQRES and ATOM records:

>d1op2a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]}
viggnecdinehrflvaffnttgffcggtlinpewvvtaahcdstnfqmqlgvhskkvln
edeqtrnpkekficpnknnnevldkdimlikldkpisnskhiaplslpssppsvgsvcri
mgwgsitpvketfpdvpycaninlldhavcqagypellaeyrtlcagivqggkdtcggds
ggplicngqfqgivsygahpcgqgpkpgiytnvfdytdwiqrniagntdatcpp

Timeline for d1op2a_:

• d1op2a_ first appeared in SCOP 1.69
  
• d1op2a_ appears in SCOPe 2.04
  
• d1op2a_ appears in SCOPe 2.06
  
• d1op2a_ appears in the current release, SCOPe 2.08