Lineage for d1op0a_ (1op0 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 465071Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 465072Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 465201Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins)
  6. 466192Protein Venom serine protease [50570] (2 species)
  7. 466196Species Hundred-pace snake (Agkistrodon acutus) [TaxId:36307] [110238] (2 PDB entries)
  8. 466197Domain d1op0a_: 1op0 A: [104019]

Details for d1op0a_

PDB Entry: 1op0 (more details), 2 Å

PDB Description: crystal structure of aav-sp-i, a glycosylated snake venom serine proteinase from agkistrodon acutus

SCOP Domain Sequences for d1op0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus)}
viggnecdinehrflvaffnttgffcggtlinpewvvtaahcdstdfqmqlgvhskkvln
edeqtrnpkekficpnknnnevldkdimlikldkpisnskhiaplslpssppsvgsvcri
mgwgsitpvketfpdvpycaninlldhavcqagypellaeyrtlcagivqggkdtcggds
ggplicngqfqgivsygahpcgqgpkpgiytnvfdytdwiqrniagntdatcpp

SCOP Domain Coordinates for d1op0a_:

Click to download the PDB-style file with coordinates for d1op0a_.
(The format of our PDB-style files is described here.)

Timeline for d1op0a_: