Lineage for d1op0a_ (1op0 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2796816Protein Venom serine protease [50570] (2 species)
  7. 2796820Species Hundred-pace snake (Agkistrodon acutus) [TaxId:36307] [110238] (2 PDB entries)
    Uniprot Q9I8X1
  8. 2796821Domain d1op0a_: 1op0 A: [104019]
    complexed with so4

Details for d1op0a_

PDB Entry: 1op0 (more details), 2 Å

PDB Description: crystal structure of aav-sp-i, a glycosylated snake venom serine proteinase from agkistrodon acutus
PDB Compounds: (A:) Venom serine proteinase

SCOPe Domain Sequences for d1op0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]}
viggnecdinehrflvaffnttgffcggtlinpewvvtaahcdstdfqmqlgvhskkvln
edeqtrnpkekficpnknnnevldkdimlikldkpisnskhiaplslpssppsvgsvcri
mgwgsitpvketfpdvpycaninlldhavcqagypellaeyrtlcagivqggkdtcggds
ggplicngqfqgivsygahpcgqgpkpgiytnvfdytdwiqrniagntdatcpp

SCOPe Domain Coordinates for d1op0a_:

Click to download the PDB-style file with coordinates for d1op0a_.
(The format of our PDB-style files is described here.)

Timeline for d1op0a_: