Lineage for d1omob_ (1omo B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 476939Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 476940Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 478890Family c.2.1.13: Ornithine cyclodeaminase-like (Pfam 02423) [110436] (1 protein)
    contains additional alpha+beta dimerisation subdomain mostly formed by the N-terminal meander beta-sheet
  6. 478891Protein Archaeal alanine dehydrogenase [110437] (1 species)
  7. 478892Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [110438] (2 PDB entries)
  8. 478896Domain d1omob_: 1omo B: [104018]

Details for d1omob_

PDB Entry: 1omo (more details), 2.32 Å

PDB Description: alanine dehydrogenase dimer w/bound NAD (archaeal)

SCOP Domain Sequences for d1omob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1omob_ c.2.1.13 (B:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus}
metliltqeeveslismdeamnaveeafrlyalgkaqmppkvylefekgdlrampahlmg
yaglkwvnshpgnpdkglptvmalmilnspetgfplavmdatyttslrtgaaggiaakyl
arknssvfgfigcgtqayfqlealrrvfdigevkaydvrekaakkfvsycedrgisasvq
paeeasrcdvlvtttpsrkpvvkaewveegthinaigadgpgkqeldveilkkakivvdd
leqakhggeinvavskgvigvedvhatigeviaglkdgresdeeitifdstglaiqdvav
akvvyenalsknvgskikff

SCOP Domain Coordinates for d1omob_:

Click to download the PDB-style file with coordinates for d1omob_.
(The format of our PDB-style files is described here.)

Timeline for d1omob_: