![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.13: Ornithine cyclodeaminase-like (Pfam 02423) [110436] (1 protein) contains additional alpha+beta dimerisation subdomain mostly formed by the N-terminal meander beta-sheet |
![]() | Protein Archaeal alanine dehydrogenase [110437] (1 species) |
![]() | Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [110438] (2 PDB entries) |
![]() | Domain d1omob_: 1omo B: [104018] |
PDB Entry: 1omo (more details), 2.32 Å
SCOP Domain Sequences for d1omob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1omob_ c.2.1.13 (B:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus} metliltqeeveslismdeamnaveeafrlyalgkaqmppkvylefekgdlrampahlmg yaglkwvnshpgnpdkglptvmalmilnspetgfplavmdatyttslrtgaaggiaakyl arknssvfgfigcgtqayfqlealrrvfdigevkaydvrekaakkfvsycedrgisasvq paeeasrcdvlvtttpsrkpvvkaewveegthinaigadgpgkqeldveilkkakivvdd leqakhggeinvavskgvigvedvhatigeviaglkdgresdeeitifdstglaiqdvav akvvyenalsknvgskikff
Timeline for d1omob_: