Lineage for d1omoa_ (1omo A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845780Family c.2.1.13: Ornithine cyclodeaminase-like [110436] (2 proteins)
    Pfam PF02423; contains additional alpha+beta dimerisation subdomain mostly formed by the N-terminal meander beta-sheet
  6. 2845781Protein Archaeal alanine dehydrogenase [110437] (1 species)
  7. 2845782Species Archaeoglobus fulgidus [TaxId:2234] [110438] (2 PDB entries)
    Uniprot O28608 # Rossmann-fold core (101-292) begins with an N-terminal helix and ends with a beta-strand
  8. 2845783Domain d1omoa_: 1omo A: [104017]
    complexed with na, nad

Details for d1omoa_

PDB Entry: 1omo (more details), 2.32 Å

PDB Description: alanine dehydrogenase dimer w/bound NAD (archaeal)
PDB Compounds: (A:) alanine dehydrogenase

SCOPe Domain Sequences for d1omoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]}
metliltqeeveslismdeamnaveeafrlyalgkaqmppkvylefekgdlrampahlmg
yaglkwvnshpgnpdkglptvmalmilnspetgfplavmdatyttslrtgaaggiaakyl
arknssvfgfigcgtqayfqlealrrvfdigevkaydvrekaakkfvsycedrgisasvq
paeeasrcdvlvtttpsrkpvvkaewveegthinaigadgpgkqeldveilkkakivvdd
leqakhggeinvavskgvigvedvhatigeviaglkdgresdeeitifdstglaiqdvav
akvvyenalsknvgskikff

SCOPe Domain Coordinates for d1omoa_:

Click to download the PDB-style file with coordinates for d1omoa_.
(The format of our PDB-style files is described here.)

Timeline for d1omoa_: