Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.13: Ornithine cyclodeaminase-like [110436] (2 proteins) Pfam PF02423; contains additional alpha+beta dimerisation subdomain mostly formed by the N-terminal meander beta-sheet |
Protein Archaeal alanine dehydrogenase [110437] (1 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [110438] (2 PDB entries) Uniprot O28608 # Rossmann-fold core (101-292) begins with an N-terminal helix and ends with a beta-strand |
Domain d1omoa_: 1omo A: [104017] complexed with na, nad |
PDB Entry: 1omo (more details), 2.32 Å
SCOPe Domain Sequences for d1omoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} metliltqeeveslismdeamnaveeafrlyalgkaqmppkvylefekgdlrampahlmg yaglkwvnshpgnpdkglptvmalmilnspetgfplavmdatyttslrtgaaggiaakyl arknssvfgfigcgtqayfqlealrrvfdigevkaydvrekaakkfvsycedrgisasvq paeeasrcdvlvtttpsrkpvvkaewveegthinaigadgpgkqeldveilkkakivvdd leqakhggeinvavskgvigvedvhatigeviaglkdgresdeeitifdstglaiqdvav akvvyenalsknvgskikff
Timeline for d1omoa_: