Lineage for d1olme2 (1olm E:275-393)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1565036Fold b.132: Supernatant protein factor (SPF), C-terminal domain [101575] (1 superfamily)
    sandwich; 8 strands in 2 sheets; jelly-roll; similarity to the Nucleoplasmin-like/VP fold
  4. 1565037Superfamily b.132.1: Supernatant protein factor (SPF), C-terminal domain [101576] (2 families) (S)
  5. 1565038Family b.132.1.1: Supernatant protein factor (SPF), C-terminal domain [101577] (1 protein)
  6. 1565039Protein Supernatant protein factor (SPF), C-terminal domain [101578] (1 species)
  7. 1565040Species Human (Homo sapiens) [TaxId:9606] [101579] (2 PDB entries)
    Uniprot O76054
  8. 1565043Domain d1olme2: 1olm E:275-393 [104015]
    Other proteins in same PDB: d1olma1, d1olma3, d1olmc1, d1olmc3, d1olme1, d1olme3
    complexed with vtq

Details for d1olme2

PDB Entry: 1olm (more details), 1.95 Å

PDB Description: supernatant protein factor in complex with rrr-alpha-tocopherylquinone: a link between oxidized vitamin e and cholesterol biosynthesis
PDB Compounds: (E:) sec14-like protein 2

SCOPe Domain Sequences for d1olme2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1olme2 b.132.1.1 (E:275-393) Supernatant protein factor (SPF), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
kqqyehsvqisrgsshqveyeilfpgcvlrwqfmsdgadvgfgiflkkkmgerqragemt
evlpnqrynshlvpedgtltcsdpgiyvlrfdntysfihakkvnftvevllpdkaseek

SCOPe Domain Coordinates for d1olme2:

Click to download the PDB-style file with coordinates for d1olme2.
(The format of our PDB-style files is described here.)

Timeline for d1olme2: