Lineage for d1olma3 (1olm A:76-274)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 480349Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
    core: 4 turns of a (beta-alpha)n superhelix
  4. 480350Superfamily c.13.1: CRAL/TRIO domain [52087] (1 family) (S)
  5. 480351Family c.13.1.1: CRAL/TRIO domain [52088] (3 proteins)
    Pfam 00650
  6. 480361Protein Supernatant protein factor (SPF), middle domain [102205] (1 species)
    Sec14-like protein 2; contains extra C-terminal beta-sandwich domain
  7. 480362Species Human (Homo sapiens) [TaxId:9606] [102206] (2 PDB entries)
  8. 480363Domain d1olma3: 1olm A:76-274 [104010]
    Other proteins in same PDB: d1olma1, d1olma2, d1olmc1, d1olmc2, d1olme1, d1olme2

Details for d1olma3

PDB Entry: 1olm (more details), 1.95 Å

PDB Description: supernatant protein factor in complex with rrr-alpha-tocopherylquinone: a link between oxidized vitamin e and cholesterol biosynthesis

SCOP Domain Sequences for d1olma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1olma3 c.13.1.1 (A:76-274) Supernatant protein factor (SPF), middle domain {Human (Homo sapiens)}
ppeviqqylsggmcgydldgcpvwydiigpldakgllfsaskqdllrtkmrecelllqec
ahqttklgrkvetitiiydceglglkhlwkpaveaygeflcmfeenypetlkrlfvvkap
klfpvaynlikpflsedtrkkimvlganwkevllkhispdqvpveyggtmtdpdgnpkck
skinyggdiprkyyvrdqv

SCOP Domain Coordinates for d1olma3:

Click to download the PDB-style file with coordinates for d1olma3.
(The format of our PDB-style files is described here.)

Timeline for d1olma3: