Lineage for d1okza_ (1okz A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 874255Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 874256Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 874317Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 874318Protein 3-phosphoinositide dependent protein kinase-1 Pdk1 [90036] (1 species)
    AGC group; PBK subfamily; serine/threonine kinase
  7. 874319Species Human (Homo sapiens) [TaxId:9606] [90037] (13 PDB entries)
    Uniprot O15530 75-363
  8. 874326Domain d1okza_: 1okz A: [104007]
    complexed with gol, so4, ucn

Details for d1okza_

PDB Entry: 1okz (more details), 2.51 Å

PDB Description: structure of human pdk1 kinase domain in complex with ucn-01
PDB Compounds: (A:) 3-phosphoinositide dependent protein kinase 1

SCOP Domain Sequences for d1okza_:

Sequence, based on SEQRES records: (download)

>d1okza_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]}
qprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrerd
vmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsa
leylhgkgiihrdlkpenillnedmhiqitdfgtakvlspeskqaransfvgtaqyvspe
llteksackssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardl
vekllvldatkrlgceemegygplkahpffesvtwenlhqqtppklt

Sequence, based on observed residues (ATOM records): (download)

>d1okza_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]}
qprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrerd
vmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsa
leylhgkgiihrdlkpenillnedmhiqitdfgtakvlnsfvgtaqyvspellteksack
ssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlvekllvlda
tkrlgceemegygplkahpffesvtwenlhqqtppklt

SCOP Domain Coordinates for d1okza_:

Click to download the PDB-style file with coordinates for d1okza_.
(The format of our PDB-style files is described here.)

Timeline for d1okza_: