Lineage for d1okya_ (1oky A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511959Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 511960Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 512001Family d.144.1.7: Protein kinases, catalytic subunit [88854] (53 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 512002Protein 3-phosphoinositide dependent protein kinase-1 Pdk1 [90036] (1 species)
    AGC group; PBK subfamily; serine/threonine kinase
  7. 512003Species Human (Homo sapiens) [TaxId:9606] [90037] (8 PDB entries)
  8. 512008Domain d1okya_: 1oky A: [104006]

Details for d1okya_

PDB Entry: 1oky (more details), 2.3 Å

PDB Description: structure of human pdk1 kinase domain in complex with staurosporine

SCOP Domain Sequences for d1okya_:

Sequence, based on SEQRES records: (download)

>d1okya_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens)}
pqprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrer
dvmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivs
aleylhgkgiihrdlkpenillnedmhiqitdfgtakvlspeskqaransfvgtaqyvsp
ellteksackssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkard
lvekllvldatkrlgceemegygplkahpffesvtwenlhqqtppklta

Sequence, based on observed residues (ATOM records): (download)

>d1okya_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens)}
pqprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrer
dvmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivs
aleylhgkgiihrdlkpenillnedmhiqitdfgtakvlspansfvgtaqyvspelltek
sackssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlvekll
vldatkrlgceemegygplkahpffesvtwenlhqqtppklta

SCOP Domain Coordinates for d1okya_:

Click to download the PDB-style file with coordinates for d1okya_.
(The format of our PDB-style files is described here.)

Timeline for d1okya_: