Lineage for d1okjd1 (1okj D:1-106)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701285Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families) (S)
    duplication contains two domains of this fold
  5. 701800Family c.55.1.9: YeaZ-like [110633] (2 proteins)
    Pfam PF00814; ubiquitous cytoplasmic protein; annotated as Glycoprotease (Peptidase_M22 family) on the basis of one member's known extracellular activity
  6. 701807Protein Hypothetical protein YeaZ [110634] (1 species)
  7. 701808Species Escherichia coli [TaxId:562] [110635] (1 PDB entry)
  8. 701815Domain d1okjd1: 1okj D:1-106 [104004]

Details for d1okjd1

PDB Entry: 1okj (more details), 2.28 Å

PDB Description: crystal structure of the essential E. coli YeaZ protein by MAD method using the gadolinium complex "DOTMA"
PDB Compounds: (D:) hypothetical protease yeaz

SCOP Domain Sequences for d1okjd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1okjd1 c.55.1.9 (D:1-106) Hypothetical protein YeaZ {Escherichia coli [TaxId: 562]}
rilaidtateacsvalwndgtvnahfelcprehtqrilpmvqdilttsgtsltdinalay
grgpgsftgvrigigiaqglalgaelpmigvstlmtmaqgawrkng

SCOP Domain Coordinates for d1okjd1:

Click to download the PDB-style file with coordinates for d1okjd1.
(The format of our PDB-style files is described here.)

Timeline for d1okjd1: