SCOP 1.73: Domain d1ok7b2: 1ok7 B:123-244

Lineage for d1ok7b2 (1ok7 B:123-244)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (2 families)

5. Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein)
   duplication: consists of three domains of this fold

6. Protein DNA polymerase III, beta subunit [55981] (2 species)

7. Species Escherichia coli [TaxId:562] [55982] (6 PDB entries)

8. Domain d1ok7b2: 1ok7 B:123-244 [103996]

Details for d1ok7b2

PDB Entry: 1ok7, 1.65 Å

PDB Description: a conserved protein binding-site on bacterial sliding clamps

PDB Compounds: (B:) DNA polymerase III

SCOP Domain Sequences for d1ok7b2:

Sequence; same for both SEQRES and ATOM records:

>d1ok7b2 d.131.1.1 (B:123-244) DNA polymerase III, beta subunit {Escherichia coli [TaxId: 562]}
qseveftlpqatmkrlieatqfsmahqdvryylngmlfetegeelrtvatdghrlavcsm
pigqslpshsvivprkgvielmrmldggdnplrvqigsnnirahvgdfiftsklvdgrfp
dy

Timeline for d1ok7b2:

• d1ok7b2 first appeared in SCOP 1.69
  
• d1ok7b2 appears in SCOP 1.71
  
• d1ok7b2 appears in SCOP 1.75
  
• d1ok7b2 appears in the current release, SCOPe 2.08