![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
![]() | Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
![]() | Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein) duplication: consists of three domains of this fold |
![]() | Protein DNA polymerase III, beta subunit [55981] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [55982] (30 PDB entries) Uniprot P00583 |
![]() | Domain d1ok7b2: 1ok7 B:123-244 [103996] |
PDB Entry: 1ok7 (more details), 1.65 Å
SCOPe Domain Sequences for d1ok7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ok7b2 d.131.1.1 (B:123-244) DNA polymerase III, beta subunit {Escherichia coli [TaxId: 562]} qseveftlpqatmkrlieatqfsmahqdvryylngmlfetegeelrtvatdghrlavcsm pigqslpshsvivprkgvielmrmldggdnplrvqigsnnirahvgdfiftsklvdgrfp dy
Timeline for d1ok7b2: