Lineage for d1ok7b2 (1ok7 B:123-244)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2539893Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2539894Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2539895Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein)
    duplication: consists of three domains of this fold
  6. 2539896Protein DNA polymerase III, beta subunit [55981] (2 species)
  7. 2539897Species Escherichia coli [TaxId:562] [55982] (30 PDB entries)
    Uniprot P00583
  8. 2539956Domain d1ok7b2: 1ok7 B:123-244 [103996]

Details for d1ok7b2

PDB Entry: 1ok7 (more details), 1.65 Å

PDB Description: a conserved protein binding-site on bacterial sliding clamps
PDB Compounds: (B:) DNA polymerase III

SCOPe Domain Sequences for d1ok7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ok7b2 d.131.1.1 (B:123-244) DNA polymerase III, beta subunit {Escherichia coli [TaxId: 562]}
qseveftlpqatmkrlieatqfsmahqdvryylngmlfetegeelrtvatdghrlavcsm
pigqslpshsvivprkgvielmrmldggdnplrvqigsnnirahvgdfiftsklvdgrfp
dy

SCOPe Domain Coordinates for d1ok7b2:

Click to download the PDB-style file with coordinates for d1ok7b2.
(The format of our PDB-style files is described here.)

Timeline for d1ok7b2: