SCOP 1.71: Domain d1ok7b1: 1ok7 B:1-122

Lineage for d1ok7b1 (1ok7 B:1-122)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (2 families)

5. Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein)
   duplication: consists of three domains of this fold

6. Protein DNA polymerase III, beta subunit [55981] (2 species)

7. Species Escherichia coli [TaxId:562] [55982] (6 PDB entries)

8. Domain d1ok7b1: 1ok7 B:1-122 [103995]

Details for d1ok7b1

PDB Entry: 1ok7, 1.65 Å

PDB Description: a conserved protein binding-site on bacterial sliding clamps

SCOP Domain Sequences for d1ok7b1:

Sequence; same for both SEQRES and ATOM records:

>d1ok7b1 d.131.1.1 (B:1-122) DNA polymerase III, beta subunit {Escherichia coli}
mkftverehllkplqqvsgplggrptlpilgnlllqvadgtlsltgtdlememvarvalv
qphepgattvparkffdicrglpegaeiavqlegermlvrsgrsrfslstlpaadfpnld
dw

Timeline for d1ok7b1:

• d1ok7b1 first appeared in SCOP 1.69
  
• d1ok7b1 appears in SCOP 1.73
  
• d1ok7b1 appears in the current release, SCOPe 2.08