Lineage for d1ok7a3 (1ok7 A:245-366)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 733777Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 733778Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 733779Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein)
    duplication: consists of three domains of this fold
  6. 733780Protein DNA polymerase III, beta subunit [55981] (2 species)
  7. 733781Species Escherichia coli [TaxId:562] [55982] (6 PDB entries)
  8. 733784Domain d1ok7a3: 1ok7 A:245-366 [103994]

Details for d1ok7a3

PDB Entry: 1ok7 (more details), 1.65 Å

PDB Description: a conserved protein binding-site on bacterial sliding clamps
PDB Compounds: (A:) DNA polymerase III

SCOP Domain Sequences for d1ok7a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ok7a3 d.131.1.1 (A:245-366) DNA polymerase III, beta subunit {Escherichia coli [TaxId: 562]}
rrvlpknpdkhleagcdllkqafaraailsnekfrgvrlyvsenqlkitannpeqeeaee
ildvtysgaemeigfnvsyvldvlnalkcenvrmmltdsvssvqiedaasqsaayvvmpm
rl

SCOP Domain Coordinates for d1ok7a3:

Click to download the PDB-style file with coordinates for d1ok7a3.
(The format of our PDB-style files is described here.)

Timeline for d1ok7a3: