SCOP 1.69: Domain d1ojsa1: 1ojs A:22-163

Lineage for d1ojsa1 (1ojs A:22-163)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)

6. Protein Malate dehydrogenase [51849] (12 species)

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [110427] (2 PDB entries)

8. Domain d1ojsa1: 1ojs A:22-163 [103988]
   Other proteins in same PDB: d1ojsa2

Details for d1ojsa1

PDB Entry: 1ojs, 2.9 Å

PDB Description: 2.9 a resolution structure of malate dehydrogenase from archaeoglobus fulgidus in complex with nadh.

SCOP Domain Sequences for d1ojsa1:

Sequence; same for both SEQRES and ATOM records:

>d1ojsa1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus}
mklgfvgagrvgstsaftcllnldvdeialvdiaedlavgeamdlahaaagidkypkivg
gadysllkgseiivvtaglarkpgmtrldlahknagiikdiakkivenapeskilvvtnp
mdvmtyimwkesgkprnevfgm

Timeline for d1ojsa1:

• d1ojsa1 is new in SCOP 1.69
  
• d1ojsa1 appears in SCOP 1.71
  
• d1ojsa1 last appears in SCOP 1.75