Lineage for d1ojhe_ (1ojh E:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651349Fold a.214: NblA-like [109858] (1 superfamily)
    4 helices; dimer of identical alpha-hairpin subunits; open bundle
  4. 651350Superfamily a.214.1: NblA-like [109859] (1 family) (S)
  5. 651351Family a.214.1.1: NblA-like [109860] (1 protein)
    Pfam PF04485
  6. 651352Protein Phycobilisome degradation protein NblA [109861] (1 species)
  7. 651353Species Anabaena sp. PCC 7120 [TaxId:103690] [109862] (1 PDB entry)
  8. 651358Domain d1ojhe_: 1ojh E: [103980]

Details for d1ojhe_

PDB Entry: 1ojh (more details), 1.8 Å

PDB Description: crystal structure of nbla from pcc 7120
PDB Compounds: (E:) nbla

SCOP Domain Sequences for d1ojhe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojhe_ a.214.1.1 (E:) Phycobilisome degradation protein NblA {Anabaena sp. PCC 7120 [TaxId: 103690]}
ielsleqqfsirsfatqvqnmshdqakdflvklyeqmvvreatyqellkh

SCOP Domain Coordinates for d1ojhe_:

Click to download the PDB-style file with coordinates for d1ojhe_.
(The format of our PDB-style files is described here.)

Timeline for d1ojhe_: