Lineage for d1ojhd_ (1ojh D:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780506Fold a.214: NblA-like [109858] (1 superfamily)
    4 helices; dimer of identical alpha-hairpin subunits; open bundle
  4. 780507Superfamily a.214.1: NblA-like [109859] (1 family) (S)
  5. 780508Family a.214.1.1: NblA-like [109860] (1 protein)
    Pfam PF04485
  6. 780509Protein Phycobilisome degradation protein NblA [109861] (1 species)
  7. 780510Species Anabaena sp. PCC 7120 [TaxId:103690] [109862] (1 PDB entry)
    Uniprot Q8YNP7
  8. 780514Domain d1ojhd_: 1ojh D: [103979]

Details for d1ojhd_

PDB Entry: 1ojh (more details), 1.8 Å

PDB Description: crystal structure of nbla from pcc 7120
PDB Compounds: (D:) nbla

SCOP Domain Sequences for d1ojhd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojhd_ a.214.1.1 (D:) Phycobilisome degradation protein NblA {Anabaena sp. PCC 7120 [TaxId: 103690]}
nqpielsleqqfsirsfatqvqnmshdqakdflvklyeqmvvreatyqellkhqwg

SCOP Domain Coordinates for d1ojhd_:

Click to download the PDB-style file with coordinates for d1ojhd_.
(The format of our PDB-style files is described here.)

Timeline for d1ojhd_: