Lineage for d1ojhc_ (1ojh C:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.214: NblA-like [109858] (1 superfamily)
    4 helices; dimer of identical alpha-hairpin subunits; open bundle
  4. Superfamily a.214.1: NblA-like [109859] (1 family) (S)
    automatically mapped to Pfam PF04485
  5. Family a.214.1.1: NblA-like [109860] (1 protein)
    Pfam PF04485
  6. Protein Phycobilisome degradation protein NblA [109861] (1 species)
  7. Species Nostoc sp. PCC 7120 [TaxId:103690] [109862] (1 PDB entry)
    Uniprot Q8YNP7
  8. Domain d1ojhc_: 1ojh C: [103978]
    complexed with edo

Details for d1ojhc_

PDB Entry: 1ojh (more details), 1.8 Å

PDB Description: crystal structure of nbla from pcc 7120
PDB Compounds: (C:) nbla

SCOPe Domain Sequences for d1ojhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojhc_ a.214.1.1 (C:) Phycobilisome degradation protein NblA {Nostoc sp. PCC 7120 [TaxId: 103690]}
elsleqqfsirsfatqvqnmshdqakdflvklyeqmvvreatyqellkhqwgl

SCOPe Domain Coordinates for d1ojhc_ are not available.

Timeline for d1ojhc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ojha_, d1ojhb_, d1ojhd_, d1ojhe_, d1ojhf_, d1ojhg_, d1ojhh_, d1ojhi_, d1ojhj_, d1ojhk_, d1ojhl_