Lineage for d1ojhc_ (1ojh C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737669Fold a.214: NblA-like [109858] (1 superfamily)
    4 helices; dimer of identical alpha-hairpin subunits; open bundle
  4. 2737670Superfamily a.214.1: NblA-like [109859] (1 family) (S)
    automatically mapped to Pfam PF04485
  5. 2737671Family a.214.1.1: NblA-like [109860] (1 protein)
    Pfam PF04485
  6. 2737672Protein Phycobilisome degradation protein NblA [109861] (1 species)
  7. 2737673Species Nostoc sp. PCC 7120 [TaxId:103690] [109862] (1 PDB entry)
    Uniprot Q8YNP7
  8. 2737676Domain d1ojhc_: 1ojh C: [103978]
    complexed with edo

Details for d1ojhc_

PDB Entry: 1ojh (more details), 1.8 Å

PDB Description: crystal structure of nbla from pcc 7120
PDB Compounds: (C:) nbla

SCOPe Domain Sequences for d1ojhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojhc_ a.214.1.1 (C:) Phycobilisome degradation protein NblA {Nostoc sp. PCC 7120 [TaxId: 103690]}
elsleqqfsirsfatqvqnmshdqakdflvklyeqmvvreatyqellkhqwgl

SCOPe Domain Coordinates for d1ojhc_:

Click to download the PDB-style file with coordinates for d1ojhc_.
(The format of our PDB-style files is described here.)

Timeline for d1ojhc_: