SCOPe 2.02: Domain d1oj8a_: 1oj8 A:

Lineage for d1oj8a_ (1oj8 A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Amphibian cytotoxic ribonuclease [54084] (5 species)

7. Species Bullfrog (Rana catesbeiana), RNase6 [TaxId:8400] [110781] (2 PDB entries)
   Uniprot Q9DFY5

8. Domain d1oj8a_: 1oj8 A: [103975]
   complexed with so4

Details for d1oj8a_

PDB Entry: 1oj8, 1.7 Å

PDB Description: novel and retro binding modes in cytotoxic ribonucleases from rana catesbeiana of two crystal structures complexed with d(apcpgpa) and (2',5'cpg)

PDB Compounds: (A:) rc-rnase6 ribonuclease

SCOPe Domain Sequences for d1oj8a_:

Sequence; same for both SEQRES and ATOM records:

>d1oj8a_ d.5.1.1 (A:) Amphibian cytotoxic ribonuclease {Bullfrog (Rana catesbeiana), RNase6 [TaxId: 8400]}
edwdtfqkkhltdtkkvkcdvemkkalfdckktntfifarpprvqalckniknntnvlsr
dvfylpqcnrkklpchyrldgstnticltcmkelpihfagvgkcp

Timeline for d1oj8a_:

• d1oj8a_ first appeared in SCOP 1.69
  
• d1oj8a_ appears in SCOPe 2.01
  
• d1oj8a_ appears in SCOPe 2.03
  
• d1oj8a_ appears in the current release, SCOPe 2.08