Lineage for d1oj8a_ (1oj8 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928017Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2928018Protein Amphibian cytotoxic ribonuclease [54084] (5 species)
  7. 2928029Species Bullfrog (Rana catesbeiana), RNase6 [TaxId:8400] [110781] (2 PDB entries)
    Uniprot Q9DFY5
  8. 2928030Domain d1oj8a_: 1oj8 A: [103975]
    complexed with so4

Details for d1oj8a_

PDB Entry: 1oj8 (more details), 1.7 Å

PDB Description: novel and retro binding modes in cytotoxic ribonucleases from rana catesbeiana of two crystal structures complexed with d(apcpgpa) and (2',5'cpg)
PDB Compounds: (A:) rc-rnase6 ribonuclease

SCOPe Domain Sequences for d1oj8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oj8a_ d.5.1.1 (A:) Amphibian cytotoxic ribonuclease {Bullfrog (Rana catesbeiana), RNase6 [TaxId: 8400]}
edwdtfqkkhltdtkkvkcdvemkkalfdckktntfifarpprvqalckniknntnvlsr
dvfylpqcnrkklpchyrldgstnticltcmkelpihfagvgkcp

SCOPe Domain Coordinates for d1oj8a_:

Click to download the PDB-style file with coordinates for d1oj8a_.
(The format of our PDB-style files is described here.)

Timeline for d1oj8a_: