Lineage for d1oj7c1 (1oj7 C:2-387)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3019289Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily)
    2 domains: (1) alpha/beta of a Rossmann-fold topology, binds NAD (2) multihelical array
  4. 3019290Superfamily e.22.1: Dehydroquinate synthase-like [56796] (3 families) (S)
  5. 3019320Family e.22.1.2: Iron-containing alcohol dehydrogenase [69892] (6 proteins)
    Pfam PF00465
  6. 3019335Protein Hypothetical oxidoreductase yqhD [111308] (1 species)
  7. 3019336Species Escherichia coli [TaxId:562] [111309] (1 PDB entry)
    Uniprot Q46856
  8. 3019339Domain d1oj7c1: 1oj7 C:2-387 [103973]
    Other proteins in same PDB: d1oj7a2, d1oj7b2, d1oj7c2, d1oj7d2
    Structural genomics target
    complexed with bo3, cl, nzq, zn

Details for d1oj7c1

PDB Entry: 1oj7 (more details), 2 Å

PDB Description: structural genomics, unknown function crystal structure of e. coli k-12 yqhd
PDB Compounds: (C:) hypothetical oxidoreductase yqhd

SCOPe Domain Sequences for d1oj7c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oj7c1 e.22.1.2 (C:2-387) Hypothetical oxidoreductase yqhD {Escherichia coli [TaxId: 562]}
nnfnlhtptrilfgkgaiaglreqiphdarvlitygggsvkktgvldqvldalkgmdvle
fggiepnpayetlmnavklvreqkvtfllavgggsvldgtkfiaaaanypenidpwhilq
tggkeiksaipmgcvltlpatgsesnagavisrkttgdkqafhsahvqpvfavldpvyty
tlpprqvangvvdafvhtveqyvtkpvdakihdrfaegilltliedgpkalkepenydvr
anvmwaatqalngligagvpqdwathmlgheltamhgldhaqtlaivlpalwnekrdtkr
akllqyaervwnitegsdderidaaiaatrnffeqlgvpthlsdygldgssipallkkle
ehgmtqlgenhditldvsrriyeaar

SCOPe Domain Coordinates for d1oj7c1:

Click to download the PDB-style file with coordinates for d1oj7c1.
(The format of our PDB-style files is described here.)

Timeline for d1oj7c1: