Lineage for d1oiub2 (1oiu B:310-432)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540337Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 540338Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 540339Family a.74.1.1: Cyclin [47955] (4 proteins)
  6. 540350Protein Cyclin A [47956] (2 species)
  7. 540354Species Human (Homo sapiens) [TaxId:9606] [47957] (29 PDB entries)
  8. 540356Domain d1oiub2: 1oiu B:310-432 [103960]
    Other proteins in same PDB: d1oiua_, d1oiuc_

Details for d1oiub2

PDB Entry: 1oiu (more details), 2 Å

PDB Description: structure of human thr160-phospho cdk2/cyclin a complexed with a 6-cyclohexylmethyloxy-2-anilino-purine inhibitor

SCOP Domain Sequences for d1oiub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oiub2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens)}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

SCOP Domain Coordinates for d1oiub2:

Click to download the PDB-style file with coordinates for d1oiub2.
(The format of our PDB-style files is described here.)

Timeline for d1oiub2: