![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.1: Cyclin [47955] (9 proteins) |
![]() | Protein Cyclin A [47956] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries) Uniprot P20248 175-432 |
![]() | Domain d1oiub1: 1oiu B:177-309 [103959] Other proteins in same PDB: d1oiua1, d1oiua2, d1oiuc1, d1oiuc2 complexed with mg, n76, sgm |
PDB Entry: 1oiu (more details), 2 Å
SCOPe Domain Sequences for d1oiub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oiub1 a.74.1.1 (B:177-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} dyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlav nyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmeh lvlkvltfdlaap
Timeline for d1oiub1: