SCOP 1.71: Domain d1oidb2: 1oid B:26-362

Lineage for d1oidb2 (1oid B:26-362)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (9 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam 00149

5. Family d.159.1.2: 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56307] (1 protein)

6. Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56308] (1 species)

7. Species Escherichia coli [TaxId:562] [56309] (8 PDB entries)

8. Domain d1oidb2: 1oid B:26-362 [103955]
   Other proteins in same PDB: d1oida1, d1oidb1
   complexed with ni; mutant

Details for d1oidb2

PDB Entry: 1oid, 2.1 Å

PDB Description: 5'-nucleotidase (e. coli) with an engineered disulfide bridge (s228c, p513c)

SCOP Domain Sequences for d1oidb2:

Sequence; same for both SEQRES and ATOM records:

>d1oidb2 d.159.1.2 (B:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli}
yeqdktykitvlhtndhhghfwrneygeyglaaqktlvdgirkevaaeggsvlllsggdi
ntgvpesdlqdaepdfrgmnlvgydamaignhefdnpltvlrqqekwakfpllsaniyqk
stgerlfkpwalfkrqdlkiaviglttddtakignpeyftdiefrkpadeaklviqelqq
tekpdiiiaathmghydngehgcnapgdvemaralpagslamivgghsqdpvcmaaenkk
qvdyvpgtpckpdqqngiwivqahewgkyvgradfefrngemkmvnyqlipvnlkkkvtw
edgkservlytpeiaenqqmisllspfqnkgkaqlev

Timeline for d1oidb2:

• d1oidb2 first appeared in SCOP 1.69
  
• d1oidb2 appears in SCOP 1.73
  
• d1oidb2 appears in the current release, SCOPe 2.08