Lineage for d1oida1 (1oid A:363-550)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578514Fold d.114: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55815] (1 superfamily)
    core: alpha-beta(2)-alpha-beta(2)-alpha-beta; 3 layers; mixed sheet: order 31425
  4. 2578515Superfamily d.114.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55816] (2 families) (S)
  5. 2578516Family d.114.1.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55817] (1 protein)
  6. 2578517Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55818] (3 species)
  7. 2578518Species Escherichia coli [TaxId:562] [55819] (8 PDB entries)
    Uniprot P07024 26-550
  8. 2578527Domain d1oida1: 1oid A:363-550 [103952]
    Other proteins in same PDB: d1oida2, d1oidb2
    complexed with ni

Details for d1oida1

PDB Entry: 1oid (more details), 2.1 Å

PDB Description: 5'-nucleotidase (e. coli) with an engineered disulfide bridge (s228c, p513c)
PDB Compounds: (A:) protein usha

SCOPe Domain Sequences for d1oida1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oida1 d.114.1.1 (A:363-550) 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain {Escherichia coli [TaxId: 562]}
kigetngrlegdrdkvrfvqtnmgrlilaaqmdrtgadfavmsgggirdsieagdisykn
vlkvqpfgnvvvyadmtgkevidyltavaqmkpdsgaypqfanvsfvakdgklndlkikg
epvdpaktyrmatlnfnatggdgyprldnkcgyvntgfidaevlkayiqksspldvsvye
pkgevswq

SCOPe Domain Coordinates for d1oida1:

Click to download the PDB-style file with coordinates for d1oida1.
(The format of our PDB-style files is described here.)

Timeline for d1oida1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oida2