SCOP 1.73: Domain d1oi9d2: 1oi9 D:310-430

Lineage for d1oi9d2 (1oi9 D:310-430)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (4 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (28 PDB entries)

8. Domain d1oi9d2: 1oi9 D:310-430 [103951]
   Other proteins in same PDB: d1oi9a_, d1oi9c_
   complexed with mg, n20, sgm

Details for d1oi9d2

PDB Entry: 1oi9, 2.1 Å

PDB Description: structure of human thr160-phospho cdk2/cyclin a complexed with a 6-cyclohexylmethyloxy-2-anilino-purine inhibitor

PDB Compounds: (D:) cyclin a2

SCOP Domain Sequences for d1oi9d2:

Sequence; same for both SEQRES and ATOM records:

>d1oi9d2 a.74.1.1 (D:310-430) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
l

Timeline for d1oi9d2:

• d1oi9d2 first appeared in SCOP 1.69
  
• d1oi9d2 appears in SCOP 1.71
  
• d1oi9d2 appears in SCOP 1.75
  
• d1oi9d2 appears in the current release, SCOPe 2.08