Lineage for d1oi8b2 (1oi8 B:26-362)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 513455Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 513456Superfamily d.159.1: Metallo-dependent phosphatases [56300] (7 families) (S)
  5. 513478Family d.159.1.2: 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56307] (1 protein)
  6. 513479Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56308] (1 species)
  7. 513480Species Escherichia coli [TaxId:562] [56309] (8 PDB entries)
  8. 513488Domain d1oi8b2: 1oi8 B:26-362 [103945]
    Other proteins in same PDB: d1oi8a1, d1oi8b1

Details for d1oi8b2

PDB Entry: 1oi8 (more details), 2.1 Å

PDB Description: 5'-nucleotidase (e. coli) with an engineered disulfide bridge (p90c, l424c)

SCOP Domain Sequences for d1oi8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oi8b2 d.159.1.2 (B:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli}
yeqdktykitvlhtndhhghfwrneygeyglaaqktlvdgirkevaaeggsvlllsggdi
ntgvcesdlqdaepdfrgmnlvgydamaignhefdnpltvlrqqekwakfpllsaniyqk
stgerlfkpwalfkrqdlkiaviglttddtakignpeyftdiefrkpadeaklviqelqq
tekpdiiiaathmghydngehgsnapgdvemaralpagslamivgghsqdpvcmaaenkk
qvdyvpgtpckpdqqngiwivqahewgkyvgradfefrngemkmvnyqlipvnlkkkvtw
edgkservlytpeiaenqqmisllspfqnkgkaqlev

SCOP Domain Coordinates for d1oi8b2:

Click to download the PDB-style file with coordinates for d1oi8b2.
(The format of our PDB-style files is described here.)

Timeline for d1oi8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oi8b1