Class b: All beta proteins [48724] (176 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins) |
Protein dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD [101973] (1 species) |
Species Amycolatopsis orientalis [TaxId:31958] [101974] (2 PDB entries) Uniprot O52806 |
Domain d1oi6b_: 1oi6 B: [103941] complexed with gol, tmp |
PDB Entry: 1oi6 (more details), 1.4 Å
SCOPe Domain Sequences for d1oi6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oi6b_ b.82.1.1 (B:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis [TaxId: 31958]} mqarklavdgaieftprvfaddrgllilpyqeeafveahggplfrvaqtihsmskrgvvr gihytvtppgtakyvycargkamdividirvgsptfgqwdsvlmdqqdpravylpvgvgh afvaleddtvmsymlsrsyvtqdelalsaldpalglpidigvepivsdrdrvaitlaeaq rqgllpdyttsqeierrltavpv
Timeline for d1oi6b_: