Lineage for d1oi6b_ (1oi6 B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 470565Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 470566Superfamily b.82.1: RmlC-like cupins [51182] (13 families) (S)
  5. 470567Family b.82.1.1: dTDP-sugar isomerase [51183] (2 proteins)
  6. 470592Protein dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD [101973] (1 species)
  7. 470593Species Amycolatopsis orientalis [TaxId:31958] [101974] (2 PDB entries)
  8. 470595Domain d1oi6b_: 1oi6 B: [103941]

Details for d1oi6b_

PDB Entry: 1oi6 (more details), 1.4 Å

PDB Description: structure determination of the tmp-complex of evad

SCOP Domain Sequences for d1oi6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oi6b_ b.82.1.1 (B:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis}
mqarklavdgaieftprvfaddrgllilpyqeeafveahggplfrvaqtihsmskrgvvr
gihytvtppgtakyvycargkamdividirvgsptfgqwdsvlmdqqdpravylpvgvgh
afvaleddtvmsymlsrsyvtqdelalsaldpalglpidigvepivsdrdrvaitlaeaq
rqgllpdyttsqeierrltavpv

SCOP Domain Coordinates for d1oi6b_:

Click to download the PDB-style file with coordinates for d1oi6b_.
(The format of our PDB-style files is described here.)

Timeline for d1oi6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1oi6a_