![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (13 families) ![]() |
![]() | Family b.82.1.1: dTDP-sugar isomerase [51183] (2 proteins) |
![]() | Protein dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD [101973] (1 species) |
![]() | Species Amycolatopsis orientalis [TaxId:31958] [101974] (2 PDB entries) |
![]() | Domain d1oi6a_: 1oi6 A: [103940] |
PDB Entry: 1oi6 (more details), 1.4 Å
SCOP Domain Sequences for d1oi6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oi6a_ b.82.1.1 (A:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis} mqarklavdgaieftprvfaddrgllilpyqeeafveahggplfrvaqtihsmskrgvvr gihytvtppgtakyvycargkamdividirvgsptfgqwdsvlmdqqdpravylpvgvgh afvaleddtvmsymlsrsyvtqdelalsaldpalglpidigvepivsdrdrvaitlaeaq rqgllpdyttsqeierrltavp
Timeline for d1oi6a_: