Lineage for d1oh3a_ (1oh3 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 458865Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 458866Superfamily b.18.1: Galactose-binding domain-like [49785] (24 families) (S)
  5. 459181Family b.18.1.19: Family 29 carbohydrate binding module, CBM29 [89244] (1 protein)
  6. 459182Protein Non-catalytic protein 1, Ncp1 [89245] (1 species)
  7. 459183Species Piromyces equi [TaxId:99929] [89246] (4 PDB entries)
  8. 459186Domain d1oh3a_: 1oh3 A: [103938]

Details for d1oh3a_

PDB Entry: 1oh3 (more details), 1.5 Å

PDB Description: e78r mutant of a carbohydrate binding module family 29

SCOP Domain Sequences for d1oh3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oh3a_ b.18.1.19 (A:) Non-catalytic protein 1, Ncp1 {Piromyces equi}
ratytvifknasglpngydnwgwgctlsyyggamiinpqegkygavslkrnsgsfrggsl
rfdmknegkvkilvrnseadekfevetispsdeyvtyildvdfdlpfdridfqdapgngd
riwiknlvhstgsaddfvdpi

SCOP Domain Coordinates for d1oh3a_:

Click to download the PDB-style file with coordinates for d1oh3a_.
(The format of our PDB-style files is described here.)

Timeline for d1oh3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1oh3b_