Lineage for d1of1b_ (1of1 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845074Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 1845430Protein Thymidine kinase [52552] (3 species)
    contains insert all-alpha subdomain, res. 251-322
  7. 1845444Species Herpes simplex virus type 1, different strains [TaxId:10298] [52553] (33 PDB entries)
    Uniprot P03176 46-375
  8. 1845450Domain d1of1b_: 1of1 B: [103925]
    complexed with sct, so4

Details for d1of1b_

PDB Entry: 1of1 (more details), 1.95 Å

PDB Description: kinetics and crystal structure of the herpes simplex virus type 1 thymidine kinase interacting with (south)-methanocarba-thymidine
PDB Compounds: (B:) Thymidine kinase

SCOPe Domain Sequences for d1of1b_:

Sequence, based on SEQRES records: (download)

>d1of1b_ c.37.1.1 (B:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]}
mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
rldqgeisagdaavvmtsaqitmgmpyavtdavlaphiggeagsshapppaltlifdrhp
iaallcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpge
rldlamlaairrvygllantvrylqcggswredwgqlsgtavppqgaepqsnagprphig
dtlftlfrapellapngdlynvfawaldvlakrlrsmhvfildydqspagcrdallqlts
gmvqthvttpgsipticdlartfaremgea

Sequence, based on observed residues (ATOM records): (download)

>d1of1b_ c.37.1.1 (B:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]}
mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
rldqgeisagdaavvmtsaqitmgmpyavtdavlaphiggeapppaltlifdrhpiaall
cypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrgerldlamla
airrvygllantvrylqcggswredwgqlsgtpqsnagprphigdtlftlfrapellapn
gdlynvfawaldvlakrlrsmhvfildydqspagcrdallqltsgmvqthvttpgsipti
cdlartfaremgea

SCOPe Domain Coordinates for d1of1b_:

Click to download the PDB-style file with coordinates for d1of1b_.
(The format of our PDB-style files is described here.)

Timeline for d1of1b_: