| Class b: All beta proteins [48724] (176 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
| Protein Spore coat protein A, CotA [89219] (1 species) |
| Species Bacillus subtilis [TaxId:1423] [89220] (9 PDB entries) Uniprot P07788 |
| Domain d1of0a3: 1of0 A:357-510 [103923] complexed with c1o, cu1, ebs, gol, oxy |
PDB Entry: 1of0 (more details), 2.45 Å
SCOPe Domain Sequences for d1of0a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1of0a3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]}
sypsvqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptr
gthpihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlr
iaatfgpysgryvwhchilehedydmmrpmditd
Timeline for d1of0a3: