SCOPe 2.04: Domain d1of0a3: 1of0 A:357-510

Lineage for d1of0a3 (1of0 A:357-510)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Spore coat protein A, CotA [89219] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [89220] (9 PDB entries)
   Uniprot P07788

8. Domain d1of0a3: 1of0 A:357-510 [103923]
   complexed with c1o, cu1, ebs, gol, oxy

Details for d1of0a3

PDB Entry: 1of0, 2.45 Å

PDB Description: crystal structure of bacillus subtilis cota after 1h soaking with abts

PDB Compounds: (A:) spore coat protein a

SCOPe Domain Sequences for d1of0a3:

Sequence; same for both SEQRES and ATOM records:

>d1of0a3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]}
sypsvqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptr
gthpihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlr
iaatfgpysgryvwhchilehedydmmrpmditd

Timeline for d1of0a3:

• d1of0a3 first appeared in SCOP 1.69
  
• d1of0a3 appears in SCOPe 2.03
  
• d1of0a3 appears in SCOPe 2.05
  
• d1of0a3 appears in the current release, SCOPe 2.08