Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
Protein Spore coat protein A, CotA, middle domain [418913] (2 species) |
Species Bacillus subtilis [TaxId:1423] [419335] (13 PDB entries) Uniprot P07788 |
Domain d1of0a2: 1of0 A:183-356 [103922] Other proteins in same PDB: d1of0a1, d1of0a3 complexed with c1o, cu1, ebs, gol, oxy has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1of0 (more details), 2.45 Å
SCOPe Domain Sequences for d1of0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1of0a2 b.6.1.3 (A:183-356) Spore coat protein A, CotA, middle domain {Bacillus subtilis [TaxId: 1423]} klpsdeydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvwpy leveprkyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaerydi iidftayegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkyla
Timeline for d1of0a2: