SCOPe 2.06: Domain d1oe3a2: 1oe3 A:160-336

Lineage for d1oe3a2 (1oe3 A:160-336)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (24 PDB entries)
   Uniprot O68601 25-360 ! Uniprot O68601 26-359 ! Uniprot O68601

8. Domain d1oe3a2: 1oe3 A:160-336 [103904]
   complexed with cu, pg4

Details for d1oe3a2

PDB Entry: 1oe3, 1.15 Å

PDB Description: atomic resolution structure of 'half apo' nir

PDB Compounds: (A:) dissimilatory copper-containing nitrite reductase

SCOPe Domain Sequences for d1oe3a2:

Sequence; same for both SEQRES and ATOM records:

>d1oe3a2 b.6.1.3 (A:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}
qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapipr

Timeline for d1oe3a2:

• d1oe3a2 first appeared in SCOP 1.69
  
• d1oe3a2 appears in SCOPe 2.05
  
• d1oe3a2 appears in SCOPe 2.07
  
• d1oe3a2 appears in the current release, SCOPe 2.08